PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G0175
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 1081aa    MW: 119374 Da    PI: 4.9774
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G0175genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.4e-19100146148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde+l +av+q+ g++Wk+Ia+++   Rt+ qc +rwqk+l
      Gh_A07G0175 100 KGQWTPEEDEILRKAVQQFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 146
                      799****************************9.************986 PP

2Myb_DNA-binding64.91.5e-20152198148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEdel++++v+++G++ W+tIa++++ gR +kqc++rw+++l
      Gh_A07G0175 152 KGPWSKEEDELIIELVNKFGPKKWSTIAQHLP-GRIGKQCRERWHNHL 198
                      79******************************.*************97 PP

3Myb_DNA-binding49.87.8e-16204246145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+  ++ ++ gRt++ +k++w+
      Gh_A07G0175 204 KEAWTQEEELALIRAHQVYGNK-WAELSKFLP-GRTDNAIKNHWN 246
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.82695146IPR017930Myb domain
SMARTSM007173.4E-1699148IPR001005SANT/Myb domain
PfamPF002491.7E-16100146IPR001005SANT/Myb domain
SuperFamilySSF466895.6E-16101156IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-25102158IPR009057Homeodomain-like
CDDcd001671.03E-14103146No hitNo description
PROSITE profilePS5129433.034147202IPR017930Myb domain
SuperFamilySSF466894.87E-32149245IPR009057Homeodomain-like
SMARTSM007171.5E-19151200IPR001005SANT/Myb domain
PfamPF002493.6E-19152198IPR001005SANT/Myb domain
CDDcd001674.45E-17154198No hitNo description
Gene3DG3DSA:1.10.10.603.8E-28159201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-22202253IPR009057Homeodomain-like
SMARTSM007179.1E-16203251IPR001005SANT/Myb domain
PROSITE profilePS5129420.316203253IPR017930Myb domain
PfamPF002493.8E-14204247IPR001005SANT/Myb domain
CDDcd001673.46E-12206246No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1081 aa     Download sequence    Send to blast
MALKALKFGS HFLTNFISSV GSANVHRFYL LSFPVPRFLV FGAQFGELEL GYASLFISKG  60
TMDGDGTIST PSVGPSISDG AQRMRAFHGR TSGPTRRSTK GQWTPEEDEI LRKAVQQFKG  120
KNWKKIAECF KDRTDVQCLH RWQKVLNPEL VKGPWSKEED ELIIELVNKF GPKKWSTIAQ  180
HLPGRIGKQC RERWHNHLNP AINKEAWTQE EELALIRAHQ VYGNKWAELS KFLPGRTDNA  240
IKNHWNSSVK KKVDSYVASG LLEQFQFPLL TNQSQSMPSS SSRIQRNVDD SGAKCRTEAD  300
DISECSQEPT MAGCFQPTRD LANAAVHTRE HLHLTEISGV EKEKNSCPAP CSEEYYPSLE  360
DVSFSIPEIP GEAGYSTCGD YQFGLTNLAN PSSLELGQES SGFKNHCIGT SRCHEVMNVA  420
LQTSVGLNTP TSFINTVTTS DKQEHMLITD DECCRVLFSE TVTDGCFVSE DLTQGYNMVE  480
SCSHTHASSS KASDIQKSET GITPALQSNC PSRSEVLPTS CCQSFVSPLI SVEDGTTLIY  540
GREPGQLTGQ PFETQEQELT MNVHDGFICT SDDHTYDTDM QERSYLDKDS PKLVPVNTFG  600
SESNAMQTCP IVDDKPNLPA EQDEGGLCYE PPRFPSLDIP FFSCDLISSG SDKQQEYSPF  660
GIRQLMMSSM NCISPFRLSD SPLWDDSPDA KLKSAAKTFT GTPSILKKRH RDLLSPLSER  720
RCGKKLETDM TSNLSKEFSC LDVMLDASGT GNKSQESPSE CKTKSGVFIE EKENLCQAVD  780
QERYNGGDHT EPLDDEAQKK GSNGINSQGD IEKEACVTDA KDKTYANASD KIVQRPPEVL  840
VEHNLNDLLL FSPEHVGLKA DRPLLSSSTL TPRNQGLASE CFSGNACIIV SSPTPQIKNS  900
ESQSISSATL ENLADNAGNG AAIENYNMFS ETPLKRSIES PSAWKSPWFI NSFVPGPRID  960
TEITIEDIGY LMSPPDRSYD AIGLMKQLSE HTATTYADAL EVLGNETPES IVKGRRSNNS  1020
KMDKENNQME TQSHLASDIL VERRILDFSE CGTPGNGTEN RKSSTAVSFS SPSSYLLKGC  1080
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-721002536159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-721002536159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437928.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_012437996.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D2LU270.0A0A0D2LU27_G
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein